Bacterial taxon 615
Locus BVG96_15180
Protein ASL98890.1
outer membrane protein assembly factor BamE
Serratia marcescens Strain UMH9
Length 112 aa, Gene n/a, UniProt n/a
>ASL98890.1|Serratia marcescens Strain UMH9|outer membrane protein assembly factor BamE
MRCKTLTAAAVVLVMLTAGCSTFEKVVYRPDINQGNYLTSTDVAKIQKGMTQQQVAYTLGTPMLQDPFGTQTWFYVFRQQPGHEDITQQTLTLTFDSAGVLTDIQNKPALTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.94 | 8.6e-5 | ●●●●○ -3.48 | -3.476967921335393 | 28536292 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)