Bacterial taxon 615
Locus BVG96_02675
Protein ASL96571.1
replication initiation regulator SeqA
Serratia marcescens Strain UMH9
Length 180 aa, Gene n/a, UniProt n/a
>ASL96571.1|Serratia marcescens Strain UMH9|replication initiation regulator SeqA
MKTIEVDEELYRYIASHTQHIGESASDILRRMLKFTAGQPVRALPAASAPQSVELEKAAPAQRPRDRVRAMRELLLSDEYAEQNKAVNRFMLVLSTLYTLDAAGFAAATEALTGRTRTYFAGDQQTLLANGTHTKPKHVPGTPYWVITNTNTGRKRSMIEHIMQAMQFPAELIEKVCGTV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3 | 0.032 | ●●●●○ -3.54 | -3.538213917755424 | 28536292 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)