Bacterial taxon 243277
Locus VC_0469
Protein NP_230123.1
16S rRNA (uracil(1498)-N(3))-methyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 243 aa, Gene n/a, UniProt Q9KUP6
>NP_230123.1|Vibrio cholerae O1 biovar El Tor str. N16961|16S rRNA (uracil(1498)-N(3))-methyltransferase
MRIPRIYHPEPIHQLGTVALSEDAAGHIGRVLRMQAGQEVLLFDGLGAEFPAVISEVGKKQVLVNITERVENSIESPLDLHLGQVISRGDKMEFTIQKSVELGVTTITPLLSERCGVKLDEKRFEKKIQQWQKIAISACEQCGRNTVPEIRPIMDLEAWCAEPTEALKLNLHPRAKYSLNTLPTPVSKVRLLIGPEGGLSAEEIDMTRRYQFEETLLGPRVLRTETAALTAIAALQVRFGDLG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.43 | 0.029 | ○○○○○ 1.07 | 1.066565717165777 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)