Bacterial taxon 243277
Locus VC_1635
Protein NP_231272.1
16S rRNA pseudouridine(516) synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 231 aa, Gene rsuA, UniProt Q9KRK5
>NP_231272.1|Vibrio cholerae O1 biovar El Tor str. N16961|16S rRNA pseudouridine(516) synthase
MRLDKFLCDALGTTRKEATQLLKSGEVTVDDVVQKSGAFKLKETSCVEWQGREITLHGPRYIMMHKPDGVVCSHEDGFNQTALTLLDEVNIQDLHFAGRLDVDTTGLLLITDDGQWSHRVTSPKHKCEKTYRVWLADPIQADYAEQFNRGIELRGERELTLPAQLEVISETEVLLTIHEGKYHQVKRMFAALGNKVIGLHRERIGQITLDETLEPGEYRYLTEEEVASIWK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.99 | 0.0015 | ●○○○○ -0.05 | -0.05226187555496838 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)