Bacterial taxon 243277
Locus VC_0801
Protein NP_230450.1
2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 313 aa, Gene citG, UniProt Q9KTT7
>NP_230450.1|Vibrio cholerae O1 biovar El Tor str. N16961|2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase
MTIPAALDLLLELPSQASSSSGSRTFSLPRLVGHLAYHAMMLEVHLTPKPGLVDTANNGAHRDMDLNTFIASAEAIAPYLHSFVSAGWESAGNPAAQLLSALRPIGIEAEQAMFAATQGVNTHKGMIFILGLICGSVGWLKANQLKIDAQHIGETIRQACQFLVIDELKAKRDCEPETAGERIYRQYGLTGARGEAASGLAMVMQHALPAYQACLTKGASTEQALWHTLLVLMANNNDSNLVSRGGLAGLHFVQEQAQQLLAKGGFLYQEIEQALTALDSVLIEKHLSPGGSADLLAATWLIYELVQLFKVRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.9 | 0.00051 | ○○○○○ 0.82 | 0.8212786777194504 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)