Bacterial taxon 243277
Locus VC_0525
Protein NP_230176.2
2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 168 aa, Gene n/a, UniProt Q9KUJ5
>NP_230176.2|Vibrio cholerae O1 biovar El Tor str. N16961|2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
MITAYIGVGSNQDRHQSIEAGLRALAELASQWRLSTIYECPSVGFASHPFFNLMVEMETELALPELMKQLKAIELRCGRLPNAQKYQDRTLDLDIVLYGDCVSENDPVLPRPDIYRYPFVIQPLYELCPQRVIAGDGRTVEQIWQQAQDLASLTPVPIWFSINEKKQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.43 | 0.041 | ○○○○○ 0.6 | 0.6010502712976872 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)