Bacterial taxon 243277
Locus VC_0593
Protein NP_230243.1
2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 167 aa, Gene n/a, UniProt Q9KUC9
>NP_230243.1|Vibrio cholerae O1 biovar El Tor str. N16961|2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
MMLAYIAIGSNLGDPVAQAQLAIQQLTLLPKSRLIAASSLYSSTPMGPQNQPDYINAVAAIETELTPLELLDCTQRIELEQGRVRKSERWGPRTLDLDIVLYGNEVIETERLTIPHYGMKVREFVLYPLAEIAPNLTLPDGTEIQALLQQVPLNGLSIWHSPTSSKD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.81 | 1.0e-13 | ●●●●○ -3.2 | -3.1969746532548076 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)