Bacterial taxon 243277
Locus VC_0528
Protein NP_230179.1
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 232 aa, Gene ispD, UniProt Q9KUJ2
>NP_230179.1|Vibrio cholerae O1 biovar El Tor str. N16961|2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
MNNMTAIVPAAGVGSRMQADRPKQYLTLLDKTVLEHTVEHLLEHPLIEHVVVAVSADDPYFANLPLAHHPRVIRVDGGKERADSVLSALEYVCQHRLSEWVLVHDAARPCVTHADITQLITTALAHPIGAILASPVRDTMKRGDHLQQIVHTVDRTALWHALTPQMFRAQSLRERLFAALQQQVTITDEASAFEWRGEKPALVAGRADNLKITQPEDLALAEFYLSRNKEKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.29 | 0.047 | ●○○○○ -0.19 | -0.1892989386284598 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)