Bacterial taxon 243277
Locus VC_2003
Protein NP_231637.2
23S rRNA (guanine(745)-N(1))-methyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 272 aa, Gene n/a, UniProt Q9KQJ5
>NP_231637.2|Vibrio cholerae O1 biovar El Tor str. N16961|23S rRNA (guanine(745)-N(1))-methyltransferase
MTFLCPLCEHPLTLNQNTYACINRHQFDVAKEGYVNLMPVQHKRSKDPGDNKEMTQARRRFLHTGHYAPMREKVATLCQTYLTDRQQTLLDIGCGEGYYTDFFAKALRQQDSEAQIFGLDISKIAIRYAAKRYPECQFAVASSHRLPFANQSLDGVIRIYAPCKDTELERCIKIGGIVITVTPAARHLYQFKQGIYDQVRLHEEQPETLSGFELVEECKLHYPMALNGSEAADLLQMTPFAWRASEDFKHRVSQSDTFECEADFMLRVYRRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.5 | 0.0046 | ○○○○○ 0.63 | 0.6349750674450089 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)