Bacterial taxon 243277
Locus VC_1140
Protein NP_230785.2
23S rRNA pseudouridine synthase E
Vibrio cholerae O1 biovar El Tor str. N16961
Length 241 aa, Gene rluE, UniProt Q9F855
>NP_230785.2|Vibrio cholerae O1 biovar El Tor str. N16961|23S rRNA pseudouridine synthase E
MSSRLSSDATSSSSDQRKSHFKQRAAKNAGHPPTRANRKSVANKKKNATQTALSPKRPLSPAERKVILFNKPYDTLSQFTDGDGRKTLADYIPIKDVYAAGRLDRDSEGLLILTNDGILQARLTQPQSKAPKTYWVQVEGSPQESDLEALRHGVTLKDGPTLPAKVDIMPEPTLWPRNPPVRFRAAIPTTWLAITLMEGRNRQVRRMTAHIGFPTLRLIRYSMGDWNLGDLQPGEWREVTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.67 | 0.014 | ○○○○○ 0.1 | 0.09777331241087818 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)