Bacterial taxon 243277
Locus VC_0297
Protein NP_229952.1
3-dehydroquinate dehydratase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 150 aa, Gene aroQ, UniProt Q9KV60
>NP_229952.1|Vibrio cholerae O1 biovar El Tor str. N16961|3-dehydroquinate dehydratase
MTAKSRILVLNGPNLNLLGLREPTHYGSQTLEQIVAILRDQAQKADIELEHLQSNREYELIEAIHQAFGKVDFIIINPAAFTHTSVALRDALLGVAIPFIEVHLSNVHAREPFRHHSYLSDKAQGVICGLGAQGYEFALSAAIRALQAKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.63 | 1.5e-8 | ●●●○○ -2.19 | -2.1925175603854936 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)