Bacterial taxon 243277
Locus VC_1507
Protein NP_231148.2
3-deoxy-7-phosphoheptulonate synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 353 aa, Gene n/a, UniProt Q9KRX6
>NP_231148.2|Vibrio cholerae O1 biovar El Tor str. N16961|3-deoxy-7-phosphoheptulonate synthase
MPLKTDELRTQALGPMPTPAELSHAHPITDEVALRIAQSRRQIESILTGEDDRLLVIVGPCSVHDTDAALDYARRLAALQENYTDELFVVMRTYFEKPRTVVGWKGLITDPNLDGSYALETGLNKARKLLLDVNKLGLATATEFLDMITGQYIADLITWGAIGARTTESQIHREMASALSCPVGFKNGTNGNVKIAIDAIRAAKASHYFYSPDKNGRMTVYRTSGNPFGHIILRGGDSGPNFDAASINEACQQLAQFNLPERLVVDFSHANCQKQHRKQVDVARDICQQIEAGSHKIAGIMAESFLVEGNQPMHDLNNLTYGLSITDPCLGWKDTATMLDMLAQSIKVRRSRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.34 | 2.0e-6 | ●○○○○ -0.67 | -0.6735579383903066 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)