Bacterial taxon 243277
Locus VC_A0242
Protein NP_232640.1
3-keto-L-gulonate-6-phosphate decarboxylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 215 aa, Gene n/a, UniProt Q9KMS8
>NP_232640.1|Vibrio cholerae O1 biovar El Tor str. N16961|3-keto-L-gulonate-6-phosphate decarboxylase
MTKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFWP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.98 | 7.3e-7 | ●●○○○ -1.55 | -1.5507188748488991 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)