Bacterial taxon 243277
Locus VC_0052
Protein NP_229711.1
5-(carboxyamino)imidazole ribonucleotide mutase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene purE, UniProt Q9KVT7
>NP_229711.1|Vibrio cholerae O1 biovar El Tor str. N16961|5-(carboxyamino)imidazole ribonucleotide mutase
MTVGIIMGSKSDWPTMKHAAEMLDQFGVAYETKVVSAHRTPHLLADYASSAKERGLQVIIAGAGGAAHLPGMTAAFTSLPVLGVPVQSRALSGLDSLYSIVQMPKGIAVGTLAIGEAGAANAGLLAAQIIGIHNPEVMSKVEAFRAKQTQSVLDNPNPAEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.81 | 9.4e-13 | ●●●●○ -3.2 | -3.1959095553171886 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)