Bacterial taxon 243277
Locus VC_2669
Protein NP_232297.1
5-carboxymethyl-2-hydroxymuconate delta-isomerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 116 aa, Gene n/a, UniProt Q9KNR2
>NP_232297.1|Vibrio cholerae O1 biovar El Tor str. N16961|5-carboxymethyl-2-hydroxymuconate delta-isomerase
MPNLVMEYSNSVDERINVQGLLEDLHRAAIDSGLFEISSVKSRALRCHHWLIGDEGDSVDFIHLSFELLAGRSPEQKRELSRKLMEILAAKASHVRSLTINIRDMDTDCFQKVINR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.61 | 0.033 | ○○○○○ 0.13 | 0.12580262726387959 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)