Bacterial taxon 243277
Locus VC_2679
Protein NP_232307.1
50S ribosomal protein L31
Vibrio cholerae O1 biovar El Tor str. N16961
Length 72 aa, Gene rpmE, UniProt Q9KNQ2
>NP_232307.1|Vibrio cholerae O1 biovar El Tor str. N16961|50S ribosomal protein L31
MKAGIHPEYKAVNATCSCGNSFVFNSTLGKDTMHLDVCDKCHPFYSGKQRIVDTGGRVERFNKRFGALSAKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.58 | 0.021 | ○○○○○ 0.14 | 0.13680046009250624 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)