Bacterial taxon 243277
Locus VC_0219
Protein NP_229876.1
50S ribosomal protein L33
Vibrio cholerae O1 biovar El Tor str. N16961
Length 55 aa, Gene rpmG, UniProt Q9KVC7
>NP_229876.1|Vibrio cholerae O1 biovar El Tor str. N16961|50S ribosomal protein L33
MAKGIREKIRLVSSAGTGHFYTTDKNKRNMPGKFEIKKYDPVVRQHVVYKEAKIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.32 | 6.8e-7 | ●●●○○ -2.05 | -2.050762115723852 | 24331463 |
Retrieved 1 of 1 entries in 9.6 ms
(Link to these results)