Bacterial taxon 243277
Locus VC_2268
Protein NP_231899.2
6,7-dimethyl-8-ribityllumazine synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 156 aa, Gene ribH, UniProt Q9KPU4
>NP_231899.2|Vibrio cholerae O1 biovar El Tor str. N16961|6,7-dimethyl-8-ribityllumazine synthase
MKVIEGGFPAPNAKIAIVISRFNSFINESLLSGAIDTLKRHGQISDDNITVVRCPGAVELPLVAQRVAKTGDYDAIVSLGCVIRGGTPHFDYVCSEMNKGLAQVSLEFSIPVAFGVLTVDTIDQAIERAGTKAGNKGAEAALSALEMINVLSEIDS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.12 | 0.0036 | ●○○○○ -0.57 | -0.5723995059723346 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)