Bacterial taxon 243277
Locus VC_2520
Protein NP_232149.1
ABC transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 267 aa, Gene n/a, UniProt Q9KP56
>NP_232149.1|Vibrio cholerae O1 biovar El Tor str. N16961|ABC transporter ATP-binding protein
MSQSDLVTIKNLRFSRSQRVIFDDIDLHVPKGKVTAIMGPSGIGKTTLLRLIGGQLLPEQGEIWFDGENIPTLSRRKLYRARKKMSMLFQSGALFTDLNVFDNVAYPLREHTELDEAMIKTLVLLKLEAVGLRGAAYLMPSELSGGMARRAALARAIALDPELIMYDEPFVGQDPITMGVLVELIRNLNRALGVTSVVVSHDVPEVMSIADWVYLLADGKVIAQGSPQALRDNPDPRVQQFLCGDADGPVPFRFPAQPIEQELFSAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.05 | 2.2e-9 | ●●●○○ -2.39 | -2.386908103256498 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)