Bacterial taxon 243277
Locus VC_1459
Protein NP_231102.1
accessory cholera enterotoxin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 97 aa, Gene ace, UniProt P38441
>NP_231102.1|Vibrio cholerae O1 biovar El Tor str. N16961|accessory cholera enterotoxin
MMLMMDTLYDWLIDGFTWLVIKLGIMWIESKIFVIQFFWEMSQKVIDMFTIYPLIQQAIDMLPPQYSGFLFFLGLDQALAIVLQALMTRFALRALNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2 | 5.6e-5 | ●○○○○ -0.52 | -0.5168709828350316 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)