Bacterial taxon 243277
Locus VC_0252
Protein NP_229909.1
acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 188 aa, Gene n/a, UniProt H9L4Q4
>NP_229909.1|Vibrio cholerae O1 biovar El Tor str. N16961|acetyltransferase
MSGNGYYSEDVLKQMGFSSLGKNVKISEKASLYGISRISIGSNVRIDDYVTISAGVGGVEIGSHVHIGVYSSLIGAGKITLEDFVGVSGRVSIYSSSDDYTGMAMSNPTVPEELTKVTSLPVLIKKHSILGAGCVVLPKVIVGEGVSVGALSLVNKSLDDWHIYSGNPIQKFIRKARKPLELEKKLIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.02 | 3.8e-9 | ●●●○○ -2.37 | -2.373618377370333 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)