Bacterial taxon 243277
Locus VC_A0263
Protein NP_232661.1
acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 180 aa, Gene n/a, UniProt Q9KMQ7
>NP_232661.1|Vibrio cholerae O1 biovar El Tor str. N16961|acetyltransferase
MNFSLYKSQQKPEIINLFQNTFSDSEGSEEGTVIGTLVSDFLSQPLQEDDLFVFVACDDHQRVVGSILFSKLSFPNEENVFLLAPVAVATKWHGQGIGQALIRFGLEALKTKGVSIVMTYGDIRFYSKVGFTAINEERIQAPLTLSYPEGWLAQSLTGKAITPISGKPTCLEAIANPIYW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.22 | 2.5e-5 | ○○○○○ 0.22 | 0.22483981207025322 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)