Bacterial taxon 243277
Locus VC_A0400
Protein NP_232794.1
acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 151 aa, Gene n/a, UniProt Q9K2Q6
>NP_232794.1|Vibrio cholerae O1 biovar El Tor str. N16961|acetyltransferase
MRNMDIKLRPIESEEFDSLFSVVKQGIYSHVDAVFGWDDDFQRKRLKRDYDPSWFYWVQQGGQRIGMLCFKPYDNVIHVHLLVVFPEFQNQKFGEKIMSYVHKLADAEGRNRVTLSSFIRNEAAVRFYKSLGYQLIDSDEHFYSLSLQISS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.56 | 0.02 | ○○○○○ 0 | 0.0016093129048520918 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)