Bacterial taxon 243277
Locus VC_A0417
Protein NP_232811.1
acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 178 aa, Gene n/a, UniProt Q9K330
>NP_232811.1|Vibrio cholerae O1 biovar El Tor str. N16961|acetyltransferase
MFIESLKIRLRSLEVEDAESFYQWSGDREVTQFSLSAYAYPQSRSDIAKWLSEINSSSKTISFGIECKESQKLIGYAGISGISSLNRSGEYFILIGDKAFWGKGLGTEVTRLVTNYGFRELGLHRIELTAYCDNVAAVKAYENAGYQHEGIKRESGYRNGRFMDKVQMSVLSREWPAT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.32 | 0.0027 | ○○○○○ 0.16 | 0.159879992353617 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)