Bacterial taxon 243277
Locus VC_A0941
Protein NP_233325.1
acyl-CoA thioesterase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 162 aa, Gene n/a, UniProt Q9KL09
>NP_233325.1|Vibrio cholerae O1 biovar El Tor str. N16961|acyl-CoA thioesterase
MSSGKREITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVGNLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHCIVIMVAVDEAGKPSPVPEWIPQTQEDQELRASAIRLMNMRTEIGEEMEAHVKYLKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.5 | 0.029 | ○○○○○ 0.04 | 0.03986197495548187 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)