Bacterial taxon 243277
Locus VC_1589
Protein NP_231229.1
alpha-acetolactate decarboxylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 261 aa, Gene n/a, UniProt Q9KRP7
>NP_231229.1|Vibrio cholerae O1 biovar El Tor str. N16961|alpha-acetolactate decarboxylase
MNPLLSAHCSCSQEIAQQFAHYQHISGEGEIYQTSLMSALIAGVYEGATTIAQLLEHGDFGLGTFNELDGELIAFDRQVFQLRADGSAQPAHPEQQTPFAVFTFFKADIELPITERMTREQVHQLIDRLVPSDNLFCAIRIDGTFPSVQTRTVPKQQRPYRPMLEVVKQQPVFRFQQQHGVIAGFRSPQYTTGINVPGYHEHFITQQRTGGGHIQDYIIRSGFLQIGRVSRLVVDTPVSRDFLEANLTPNNIRTAIEAAEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.57 | 0.011 | ○○○○○ 1.13 | 1.1288489405974165 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)