Bacterial taxon 243277
Locus VC_A1040
Protein NP_233422.1
amino acid ABC transporter permease
Vibrio cholerae O1 biovar El Tor str. N16961
Length 298 aa, Gene n/a, UniProt Q9KKR2
>NP_233422.1|Vibrio cholerae O1 biovar El Tor str. N16961|amino acid ABC transporter permease
MNNYGAKSSSGYRFTLLDGGLLLAIASLIGWLYYRSEVGIHYQWHWREAWTLIFTPRADGSLPYFLQGLGATLRLSLWGMVLALVLGSLIGIARSQKAWFVRLPANAFVQLVRNIPPLVFVFIFYFFISNQLIPLLGLDELLRYHTAEVHPLITWLFGPARLWENLLSGVLCIGLLSSAYIAEIVRAGLANIPQGQWEAADSLGLPTWGKYRYVIAPQVLTAITPALAGQTISLIKDTSIISLISIQELTFVGSEIANSSGLIFEIWLIVGAAYLVLCLTLSMLFKQVEKRSLRHLSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.78 | 0.0036 | ○○○○○ 0.86 | 0.8626674880683293 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)