Bacterial taxon 243277
Locus VC_2516
Protein NP_232145.1
anti-sigma B factor antagonist
Vibrio cholerae O1 biovar El Tor str. N16961
Length 109 aa, Gene n/a, UniProt Q9KP60
>NP_232145.1|Vibrio cholerae O1 biovar El Tor str. N16961|anti-sigma B factor antagonist
MSHPQWSAENEHQFSLIGELDRETVPKLWIFLKNWQPQVKQIELSLQQVVRIDSAGMVLLIHLIEHAKVRNCHIMLSFVPEQLRTLFQLSNIEHLMSQHIAKPAEVNCG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.02 | 0.0033 | ●○○○○ -0.07 | -0.06671221196333328 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)