Bacterial taxon 243277
Locus VC_1350
Protein NP_230994.1
antioxidant
Vibrio cholerae O1 biovar El Tor str. N16961
Length 157 aa, Gene n/a, UniProt Q9KSA9
>NP_230994.1|Vibrio cholerae O1 biovar El Tor str. N16961|antioxidant
MIQIGQTLPDVQLSQRTSEGTLTHSVTTLFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDMIACVSVNDAFVMKAWGEAQNASEIAMLADGDASFTKALGLEMDTGNFGGVRSQRYAMVIENNVVTLLNVEPPKTFELSKAETVLASL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.92 | 5.6e-9 | ●●○○○ -1.87 | -1.8654641274178232 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)