Bacterial taxon 243277
Locus VC_0442
Protein NP_230096.1
ApaG protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 126 aa, Gene apaG, UniProt Q9KUS3
>NP_230096.1|Vibrio cholerae O1 biovar El Tor str. N16961|ApaG protein
MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLAVPHVLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.87 | 2.7e-6 | ○○○○○ 0 | 0.00477129757989071 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)