Bacterial taxon 243277
Locus VC_1736
Protein NP_231372.1
arginyl-tRNA-protein transferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 233 aa, Gene bpt, UniProt Q9KRA6
>NP_231372.1|Vibrio cholerae O1 biovar El Tor str. N16961|arginyl-tRNA-protein transferase
MSSDIQQIRIGLTNNHPCSYLADRMERVAVAIDPQMQTPETYEVLMANGFRRSGDTIYKPHCDHCQSCQALRIPAPDFVPSKSQKRLLKLLSQEFHWQLKPELDEDWYTLYARYIFARHRHGSMYPPNKMEFAKFARAKWLNTQYLHLYQGEKLVAIAVTDLLPNSASAFYTFYDPDISISLGTLAVLCQLNYCQQTKKQWLYLGYQIDECPAMNYKVRFNPHQRLVNQRWRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.06 | 0.047 | ●○○○○ -0.08 | -0.08376464415921403 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)