Bacterial taxon 243277
Locus VC_2541
Protein NP_232169.1
aromatic acid decarboxylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 211 aa, Gene ubiX, UniProt Q9KP38
>NP_232169.1|Vibrio cholerae O1 biovar El Tor str. N16961|aromatic acid decarboxylase
MSMNNNRTITLAWTGASGAPYGLRLLQCLLAADYQVYLLISSAARVVLATEHGLKLPANPEAAQAALVEHLGCASDKLVVCGKEDWFSPVASGSAAPKQMVVCPCSAGSVAAIAHGMSDNLIERAADVVLKERGQLLLVVRETPFSTLHLENMLKLSHMGVTIMPAAPGFYHQPQSIDDLVDFMVARILDHLGIEQALVPRWGYDQRVRGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.51 | 5.8e-11 | ●●●○○ -2.6 | -2.5989906714584685 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)