Bacterial taxon 243277
Locus VC_1068
Protein NP_230713.1
ArsR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 113 aa, Gene n/a, UniProt Q9KT37
>NP_230713.1|Vibrio cholerae O1 biovar El Tor str. N16961|ArsR family transcriptional regulator
MLPHQFFKLLADETRVRCLLMIAREEKVCVAELTEALNESQPKISRHLALLRASGVVVDIRQGQWVFYRISDQLPGWMRKQIQGLVESNCLKQEYQQDIQRLAEMTSRPQCCV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.05 | 0.033 | ○○○○○ 0.38 | 0.3822999362370156 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)