Bacterial taxon 243277
Locus VC_A0783
Protein NP_233169.1
arylesterase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 215 aa, Gene n/a, UniProt Q9KLG1
>NP_233169.1|Vibrio cholerae O1 biovar El Tor str. N16961|arylesterase
METNLDSDCAEMMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSLLAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQTVTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.93 | 0.0011 | ●○○○○ -0.23 | -0.23132065811268832 | 24331463 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)