Bacterial taxon 243277
Locus VC_1171
Protein NP_230816.1
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 469 aa, Gene trpCF, UniProt Q9KST5
>NP_230816.1|Vibrio cholerae O1 biovar El Tor str. N16961|bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKAKQPLASFHPLLTRSERDFYQALSGDNTVFILECKKASPSKGLIREEFDLDYIASVYGEYASAISVLTDEKYFQGRFEFLPQVRAQVAQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVSNEQELKRAVDLQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRDLAEFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVEKSKRFVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSELRASLPESIEIWKAYGVSDALPELLPEHIDRHLLDAKVGEQSGGTGRSFDWRLLPKHSDLMLAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.68 | 0.0011 | ●○○○○ -0.37 | -0.3690411611079608 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)