Bacterial taxon 243277
Locus VC_A0328
Protein NP_232724.1
biphenyl-2,3-diol 1,2-dioxygenase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 132 aa, Gene n/a, UniProt Q9K3D3
>NP_232724.1|Vibrio cholerae O1 biovar El Tor str. N16961|biphenyl-2,3-diol 1,2-dioxygenase
MEFLMKISHLDHLVLTVADIPTTTNFYEKVLGMKAVSFGAGRIALEFGHQKINLHQLGNEFEPKAQNVRVGSADLCFITDTVLSDAMKHVENQGVTIMEGPVKRTGAQGAITSFYFRDPDGNLIEVSTYSNT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.55 | 1.5e-14 | ●●●●● -4.49 | -4.487303550669919 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)