Bacterial taxon 243277
Locus VC_2515
Protein NP_232144.1
BolA/YrbA family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 84 aa, Gene n/a, UniProt Q9KP61
>NP_232144.1|Vibrio cholerae O1 biovar El Tor str. N16961|BolA/YrbA family protein
MDSAQVQQILQQALNLEEIHVKGEGSHYEVIAVDACFADMSRVKKQQMIYAPLMGYIQRNDIHAVTMKTFTPQEWARNKKLMSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.05 | 5.0e-5 | ●○○○○ -0.54 | -0.5382506073026263 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)