Bacterial taxon 243277
Locus VC_2614
Protein NP_232242.1
cAMP-regulatory protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 210 aa, Gene n/a, UniProt Q9KNW6
>NP_232242.1|Vibrio cholerae O1 biovar El Tor str. N16961|cAMP-regulatory protein
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHAGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERTAWVRAKTPCEVAEISFKKFRQLIQVNPDILMRLSGQMARRLQVTSQKVGDLAFLDVTGRIAQTLLNLARQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEEQNLISAHGKTIVVYGTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -8.25 | 2.1e-6 | ●●●●○ -3.4 | -3.4019252514348604 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)