Bacterial taxon 243277
Locus VC_0058
Protein NP_229717.1
carbonic anhydrase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 184 aa, Gene n/a, UniProt Q9KVT1
>NP_229717.1|Vibrio cholerae O1 biovar El Tor str. N16961|carbonic anhydrase
MMSSIRSYKGIVPKLGEGVYVDSSAVLVGDIELGDDASIWPLVAARGDVNHIRIGKRTNIQDGSVLHVTHKNAENPNGYPLCIGDDVTIGHKVMLHGCTIHDRVLVGMGSIVLDGAVIENDVMIGAGSLVPPGKRLESGFLYMGSPVKQARPLNDKERAFLVKSSSNYVQSKNDYLNDVKTVRE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.5 | 0.00019 | ○○○○○ 0.17 | 0.1744104242182774 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)