Bacterial taxon 243277
Locus VC_1441
Protein NP_231084.1
cbb3-type cytochrome c oxidase subunit II
Vibrio cholerae O1 biovar El Tor str. N16961
Length 206 aa, Gene n/a, UniProt Q9KS20
>NP_231084.1|Vibrio cholerae O1 biovar El Tor str. N16961|cbb3-type cytochrome c oxidase subunit II
MSSNSNNRHELLERNVGLLAIFIVFAISWGALVEITPLIFQKQTTEEVQNLKPYTALQLEGRDIYIREGCNVCHSQMVRPFRSETERYGHYSVAGESVWEHPFLWGSKRTGPDLARVGGRYSDEWHRVHLLNPRELVPESNMPAFPWLAKNTLDGKYTQQKMTLFRDKFGVPYTDEQIANATKDVEGKTEMDAIIAYLQSLGHAMK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.01 | 0.0023 | ●○○○○ -0.52 | -0.522849913338229 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)