Bacterial taxon 243277
Locus VC_1720
Protein NP_231356.1
chaperone protein TorD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 220 aa, Gene torD, UniProt Q9KRC2
>NP_231356.1|Vibrio cholerae O1 biovar El Tor str. N16961|chaperone protein TorD
MMQELKILNEKRAEIYWWLSSLFFKELSEQDIARYHSAEVRTFLSGLADEQSLNREVKHLVEALNRLQNRQDAQLELAADFCDLFLKSDRDSALPYASVYTDKGLLNGKPAQQMRELLGAHGVKVEQNLNEPEDHLAIQLDFLAHLAISANQIEHSAQLSSALQAQSDFISQHLLTWLPAFAERCTQFDAFGLYSAAARLALAFIQQDKHCLDELFQETH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.33 | 0.012 | ○○○○○ 0.25 | 0.2540658775064503 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)