Bacterial taxon 243277
Locus VC_1399
Protein NP_231042.1
chemotaxis protein CheR
Vibrio cholerae O1 biovar El Tor str. N16961
Length 288 aa, Gene cheR2, UniProt Q9KS61
>NP_231042.1|Vibrio cholerae O1 biovar El Tor str. N16961|chemotaxis protein CheR
MNEIVITDTDFCRFRDYFYQKTGIFFENSKRYFVDKRLLQRIELTEHQSFRGYFTYLRFQASGEELQAVINALTVNETYFFREISQLESLVEEVLDDIVRHRPGELIRIWSMPCSSGEEPYSIVLFLLEHWPKLEQVDIEIIASDIDTGILQKAAQGIFSARSVKNLPNSSLNKYFSLRADGSYQLIDDIRQSVRFTQTNLNNRAEVQKLGAMDVIFCRNLLIYFDDISRRNAVESFYEQLNPGGVLFLGHSESMSRISSIFHVKRFRKSTGYYKPHKGKSDEKSNGR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2,39 | 0,011 | ○○○○○ 1,51 | 1.5094492911563675 | 24331463 |
Retrieved 1 of 1 entries in 1,3 ms
(Link to these results)