Bacterial taxon 243277
Locus VC_1398
Protein NP_231041.1
chemotaxis protein CheY
Vibrio cholerae O1 biovar El Tor str. N16961
Length 124 aa, Gene n/a, UniProt Q9KS62
>NP_231041.1|Vibrio cholerae O1 biovar El Tor str. N16961|chemotaxis protein CheY
MMKKVMVVDDASTVRMYHKALLEEIGIFILEASNGVEALERALEMPVDLFLVDINMPKMDGFTLVREIRCRPELAGIPTVMISTESQESDRQQGIHMGANLYMVKPVNPEELQQTVTLMLGGLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.71 | 0.022 | ○○○○○ 0.08 | 0.07651535137259638 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)