Bacterial taxon 243277
Locus VC_2065
Protein NP_231697.1
chemotaxis protein CheY
Vibrio cholerae O1 biovar El Tor str. N16961
Length 130 aa, Gene n/a, UniProt Q9KQD5
>NP_231697.1|Vibrio cholerae O1 biovar El Tor str. N16961|chemotaxis protein CheY
MEAILNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFERL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.34 | 0.0049 | ●○○○○ -0.21 | -0.21499176029488934 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)