Bacterial taxon 243277
Locus VC_1457
Protein NP_231100.1
cholera enterotoxin subunit A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 258 aa, Gene ctxA, UniProt P01555
>NP_231100.1|Vibrio cholerae O1 biovar El Tor str. N16961|cholera enterotoxin subunit A
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.23 | 0.046 | ●○○○○ -0.62 | -0.6222411759728027 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)