Bacterial taxon 243277
Locus VC_0095
Protein NP_229754.1
chorismate--pyruvate lyase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 183 aa, Gene ubiC, UniProt Q9KVP6
>NP_229754.1|Vibrio cholerae O1 biovar El Tor str. N16961|chorismate--pyruvate lyase
MNNSMNQLTSLYLAALNRVTWQQPDDIEFPAPLAQQWLLEQGSLSRRMATQCEHLTVDLLSNQIMLADTLSYDETQLLASEEYLLRQVIIYGDQQPWVFGHTLIPRSSMHNQPFDFTQQGKIPLGLTVFSADNVKRDALQVGWVETELGRLLARRSRLWMNNKPMLVTELFLATSPIYSKERV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.6 | 0.0072 | ○○○○○ 0.68 | 0.6805316777953607 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)