Bacterial taxon 243277
Locus VC_0482
Protein NP_230136.1
chromosome replication initiation inhibitor protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 298 aa, Gene argP, UniProt Q9KUN3
>NP_230136.1|Vibrio cholerae O1 biovar El Tor str. N16961|chromosome replication initiation inhibitor protein
MRGLDYRWIEALDSVVSKGSFERAAEQLFISQSAVSQRIKQLEKYLAQPVLIREQPPRPTLVGKKLLGLYRRVCLIEQELVPELTNQEHVRPVSMSIATNADSLATWLLPALDKVMKSRQVELNLVIYGESRTLDKLKNGEVVGAISLEPQPITGCSAEYLGQMEYLCVASPEFYQKYFAKGVTPRSLIKAPAVSYDQYDELHNKFLWDYFAVPRDKVINHTVGSSEAFVRLALSGAAYCLIPRLQIISELESGALINMTPDFMLSYPIFWHHWQLETGVLLEISEAITAYAKSVLPQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.62 | 2.1e-6 | ●●○○○ -1.26 | -1.2647122892552118 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)