Bacterial taxon 243277
Locus VC_A0166
Protein NP_232566.1
cold shock transcriptional regulator CspA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 70 aa, Gene cspA, UniProt Q9KN00
>NP_232566.1|Vibrio cholerae O1 biovar El Tor str. N16961|cold shock transcriptional regulator CspA
MSQKMTGSVKWFNETKGFGFISQDNGGQDVFVHFKSIVSEGFKTLAEGQRVSFTVEQGKKGPQAAQVTAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.6 | 0.0023 | ○○○○○ 0.75 | 0.7509815892578064 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)