Bacterial taxon 243277
Locus VC_1461
Protein NP_231104.1
colonization factor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 82 aa, Gene cep, UniProt Q9K323
>NP_231104.1|Vibrio cholerae O1 biovar El Tor str. N16961|colonization factor
MFSSLKNKLNTFKSTLSLGVFLLFSAFANQALAAADAGLVTEVTKTLGTSKDTVIALGPLIMGVVGAIVLIVTVIGLIRKAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.88 | 0.013 | ●○○○○ -0 | -0.002032583047954117 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)