Bacterial taxon 243277
Locus VC_1715
Protein NP_231351.1
condesin subunit E
Vibrio cholerae O1 biovar El Tor str. N16961
Length 247 aa, Gene mukE, UniProt Q9KRC7
>NP_231351.1|Vibrio cholerae O1 biovar El Tor str. N16961|condesin subunit E
MAQRYKRMSSTDINEYMPENLAKAIANPLFPALDSLLRAGRHVSSDDLDNHAFLSDFEPDLALFYQRYHTELVRAPEGFFYLRPRSTSLINRSVLSELDMLVGKVLCFLYLSPERLAHEGIFTNQELYDELLTLVEEKKLMKLVTNRASGSDLDREKLFEKVRTSLRRLRRLGMVITIGDTGKFRITEAVFRFGADVRLGGDVREAQLRLIRDGEAVVHTPEPSQQSLLENPTAEYDEEQTEWEDEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.54 | 6.4e-6 | ●●○○○ -1.23 | -1.2281039316777944 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)